Words that rhyme with trial
Author: n | 2025-04-24
Near Rhymes Here is a list of the words that nearly rhyme with the word trial. The best 35 rhymes and 2025 near rhymes for the word trial using our rhyming dictionary.
Words That Rhyme with Trial - Trial Rhymes - Rhyme Finder
Rhymer is a wordsmith's dream come true for when just any word won't do.Find rhyming words with six types of rhymes:1. End Rhymes (blue/shoe)Words with ending rhyme have the same final vowel sound and following consonant sound(s). For example, if you enter the word laughter under this option, Rhymer retrieves a list of words with the ending sound er (e.g., admirer, doctor, pleasure, scholar, watercolor, and were). Other examples of ending rhyme include:hat/catplate/eightmarigold/buttonholedThis option lets you easily find exact rhymes (words in which the final vowel and consonant sounds are the same) and masculine rhymes (rhyming words with a stressed final syllable).2. Last-Syllable Rhymes (timber/harbor)Words with last-syllable rhyme have the same sounds following the last syllable boundary (commonly a consonant, a vowel, and another consonant). For example, if you enter the word explain using this option, Rhymer retrieves a list of words with the last syllable sound plain (e.g., aquaplane, biplane, plane, and plain). Other examples of last-syllable rhyme include:humanity/zestythrew/breakthroughpleat/completeThis option lets you find masculine rhymes and all other words with final syllables (stressed or unstressed) that rhyme with the word you entered.3. Double Rhymes (conviction/prediction)Words with double rhyme have the same vowel sound in the second-to-last syllable and all following sounds. For example, if you enter the word soaring using this option, Rhymer retrieves a list of words with the sound oring (e.g., adoring, exploring, pouring, scoring, touring, and restoring). Other examples of double rhyme include:walking/talkinghumming/comingnavigator/waiterThis option lets you find feminine rhymes (rhyming words with an unstressed final syllable). Words entered using this option must have at least two syllables.4. Triple Rhymes (transportation/dissertation)Words with triple rhyme have the same vowel sound in the third-to-last syllable and all following sounds. For example, if you enter the word combination using this option, Rhymer retrieves a list of words with the sound anation (e.g., explanation, coronation, destination, and imagination). Other examples of triple rhyme include:antelope/cantaloupegreenery/scenerymightily/vitallyWords entered with this option must have at least three syllables.5. Beginning Rhymes (physics/fizzle)Words with beginning rhyme have the same initial consonant sound(s) and the same first vowel sound. For example, if you enter the word plantation using this option, Rhymer retrieves a list of words with the sound pla (e.g., plan, plaque, plaster, and plateau). Other examples of beginning rhyme include:scenery/cedarcat/kangarootable/tailorThis option lets you find words with initial alliteration (the repetition of initial consonant sounds), initial assonance (the repetition of initial vowel sounds), and front rhyme (the succession of beginning sounds of words).6. First-Syllable Rhymes (carrot/caring)Words with first-syllable rhyme have the same sounds preceding the first syllable break. For example, if you enter the word explanation using this option, Rhymer retrieves a list of words with the sound ex (e.g., excavate, exhale, expert, and extra). Other examples Log inWatch hundreds of videos like Rhyme Time Ep.1 - 'at' & 'it' with Cub Club☆ Rhyme Time Ep.1 - 'at' & 'it' ☆What's the time? It's Rhyme Time! This episode of Rhyme Time features words from the 'at' and 'it' families. Play along with this interactive video by putting your thumbs up if the words rhyme or thumbs down if they don't. You'll get to read rhyming sentences as well as have the chance to get your finger out and point to the word that doesn't rhyme with the others. This video provides plenty of opportunities to practise recognising, reading and listening to rhyming words. The catchy tune will help you to remember that "words that rhyme have the same end sound!"Download Circle the RhymeDownload Colour the RhymeDownload Create a RhymeDownload Find the Rhyme - PicturesDownload Find the Rhyme - WordsDownload Rhyming CardsSeriesFavouritesPopularHistoryRhyme TimeRhyme Time Ep.1 - 'at' & 'it'Rhyme Time Ep.2 - 'ap' & 'og'Rhyme Time Ep.3 - 'in' & 'ot'Rhyme Time Ep.4 - 'un' & 'ig'Rhyme Time Ep.5 - 'ug' & 'et'Rhyme Time Ep.6 - 'ip' & 'ut'Rhyme Time Ep.7 - 'ing' & 'air'Rhyme Time Ep.8 - 'all' & 'ate'Words That Rhyme With Trial
Rhymes Near Rhymes Advanced View Related Words Descriptive Words Homophones Same Consonant Similar Sound Words that Rhyme with trial court 1 syllable bort corte dort fort mort norte ort port porte quart short snort sort sport swart thwart tort wart torte boart boort gort skort teart whort 2 syllables abort airport alport athwart carport comport consort deport distort escort exhort extort forecourt import passport purport report resort retort seaport spaceport subport support transport apport assort cavort coalport contort homeport jetport outport presort spoilsport adhort aort- athort backcourt base-court beauport besort bistort bridgeport cold-short crosscourt descort detort downcourt e-sport esport freeport frontcourt goncourt gosport half-court hot-short kill-wart kingsport mis-sort missort outsport re-sort red-short rowport short-short shreveport skyport southport stockport thrawart touggourt trashsport wesort westport 3 syllables heliport nonsupport reexport teleport ultrashort cotransport motorsport agincourt alamort all-a-mort anteport autosport azincourt azmacort caulaincourt co-transport counterfort davenport entocort gliderport kenacort life-support mckeesport misreport modiwart multisport nasacort nieuport odd-come-short out-of-court overthwart pulmicort reassort reimport self-report self-support superport symbicort williamsport worrywart More Ideas for trial court Filter Rare Words Phrases Frequency Alphabetical. Near Rhymes Here is a list of the words that nearly rhyme with the word trial. The best 35 rhymes and 2025 near rhymes for the word trial using our rhyming dictionary.Words That Rhyme With Trial - Rhyme Desk
View synonyms for rhymerhymenounidentity in sound of some part, especially the end, of words or lines of verse.a word agreeing with another in terminal sound: Find is a rhyme for mind and womankind.verse or poetry having correspondence in the terminal sounds of the lines.a poem or piece of verse having such correspondence.verb (used with object)rhymed, rhyming.to treat in rhyme, as a subject; turn into rhyme, as something in prose.to compose (verse or the like) in metrical form with rhymes.to use (a word) as a rhyme to another word; use (words) as rhymes.verb (used without object)rhymed, rhyming.to make rhyme or verse; versify.to use rhyme in writing verse.to form a rhyme, as one word or line with another:a word that rhymes with orange.to be composed in metrical form with rhymes, as verse:poetry that rhymes./ raɪm /nounidentity of the terminal sounds in lines of verse or in wordsa word that is identical to another in its terminal sound``while'' is a rhyme for ``mile''a verse or piece of poetry having corresponding sounds at the ends of the linesthe boy made up a rhyme about his teacherany verse or piece of poetryrhyme or reason this proposal has no rhyme or reasonverbto use (a word) or (of a word) to be used so as to form a rhyme; be or make identical in soundto render (a subject) into rhymeto compose (verse) in a metrical structure A similarity of sound between words, such as moon , spoon , croon , tune , and June . Rhyme is often employed in verse.Discover MoreDerived Formsˈrhymeless, adjectiveDiscover MoreOther Words Fromrhymer nouninter·rhyme verb (used without object) interrhymed interrhymingmis·rhymed adjectivenon·rhyme nounnon·rhymed adjectivenon·rhyming adjectiveoutrhyme verb (used with object) outrhymed outrhymingun·rhyme verb (used with object) unrhymed unrhymingwell-rhymed adjectiveDiscover MoreWord History and OriginsOrigin of rhyme1First recorded in 1250–1300; Middle English rime, from Old French, derivative of rimer “to rhyme,” from unattested Gallo-Romance rimāre “to put in a row,” ultimately derived from Old High German rīm “series, row”; probably not connected with Latin rhythmus “rhythm,” although current spelling (from about 1600) is apparently by association with this wordDiscover MoreWord History and OriginsOrigin of rhyme1C12: from Old French rime , from rimer to rhyme, from Old High German rīm a number; spelling influenced by rhythmDiscover MoreIdioms and PhrasesIdiomsrhyme or reason,logic, sense, or plan:There was no rhyme or reason for what they did.Discover MoreExample SentencesZack Baun’s last name rhymes with yawn, and that was pretty much the reaction Rhymes 344 Near Rhymes 0 Advanced View 338 Related Words 322 Descriptive Words 120 Homophones 0 Same Consonant 12 Similar Sound 36 Rhymes Near Rhymes Advanced View Related Words Descriptive Words Homophones Same Consonant Similar Sound Words that Rhyme with time 1 syllable chime chyme climb clime crime dime grime lime lyme mime prime rhyme slime syme thyme -zyme glime stime styme thym- trime 2 syllables airtime bedtime daytime downtime enzyme halftime lifetime longtime lunchtime mealtime meantime nighttime noontime onetime oxime pastime peacetime playtime quicklime ragtime showtime sometime springtime sublime subprime teatime uptime wartime birdlime cohnheim dreamtime facetime flextime hate crime high crime key lime maytime risetime seedtime true crime wild thyme wind chime abzyme all-time andre geim azyme bairntime becrime begrime belime berhyme berime betime big-time blenheim blindheim bog lime brooklime budtime burnt lime by-time cat thyme delime deslime dislimb durkheim end rhyme end-time eye rhyme falltime field thyme first-time floodtime flytime foretime free-climb full-time gas lime gong chime half dime half rhyme half-time hay-time head rhyme hill climb horse thyme light-time lump lime mistime mulheim niflheim noncrime ofttime old-time one-time outclimb part-time pforzheim prime-time rat rhyme real-time retime rich rhyme rock climb sand-lime schooltime septime sight rhyme slaked lime small-time sondheim space-time straight-time tail rhyme tailed rhyme trondheim two-time unlime unprime upclimb waldheim war crime wastetime white lime whole-time wild lime 3 syllables aforetime allozyme anytime christmastime cybercrime dinnertime guggenheim isozyme lysozyme maritime mesenchyme overtime pantomime paradigm summertime the sublime wintertime analcime flexitime in springtime perfect crime ribozyme suppertime xenotime aftertime anaheim anti-crime archimime basic lime basil thyme beforetime bettelheim bias crime broken rhyme caustic lime cerezyme collenchyme cream of lime creeping thyme cyclothyme cytozyme desmachyme double prime double rhyme double-time drop a dime dropped a dime drops a dime enclosed rhyme female rhyme finger lime hakamim harvesttimeWords that rhyme with trial - Prime-Rhyme
RhymesaurusRhymesaurus is no ordinary rhyming dictionary; Rhymesaurus is the perfect English language reference tool for songwriters, poets, marketers, and anyone who needs to find exactly the right word. Find rhymes in 21 different ways. Look up synonyms, antonyms, ...Category: EducationDeveloper: Purple Room Publishing| Download | Price: $29.95AnalogX Rhyme v.1 2Rhyme is a rhyming program or better said a rhyming dictionary program. Type in any word (it knows more than 100,000!), tell it how many syllables to match (or phonemes), and than click 'Rhyme'. Words appear in the dialog box, and simply use the one that ...Category: Personal and HomeDeveloper: AnalogX| Download | FreeRhyme Genie v.3.0With over 300,000 entries exceeding 170,000 phrases, 35,000 proper nouns and 48,000 titles of charted songs Rhyme Genie is the ultimate rhyming dictionary for songwriters, lyricists, poets, rappers, jingle writers, copywriters and wordsmiths alike. ...Category: Personal and HomeDeveloper: Idolumic| Download | Buy: $24.95Shipra's Dictionary v.1.0Shipra's Dictionary has a great image of popularity among Indians. The reason of its popularity is its bilingual capability. It is very well known English to Hindi dictionary. You can find the Hindi meaning of any commonly used word of English from its ...Category: UtilitiesDeveloper: Shipra Compulogies| Download | FreeRhyme v.1.0.0.0This is Rhyme, the rhyming dictionary authority. It has more words and 100% accuracy. Better than anything that is out there.One thing is for sure, writing lyrics is no longer a matter to consider. With Rhyme, it is so simple.Along there is ...Category: EducationDeveloper: CBDsignedSoft| Download | FreeBust A Rhyme v.1.0.0.0Bust A Rhyme helps you find rhyming words easily by inserting a word into the text box and pressing the find button. The application will then display words, using Abbreviations.com's rhyming dictionary, that rhyme with the submitted word. This ...Category: EducationDeveloper: McKisic Design| Download | FreeRhyme Spree v.1.3Rhyme Spree is aWords That Rhyme with Trials - Rhyming Dictionary
Refine them to find a truly harmonious rhyme that fits your creative needs. Multisyllabic Rhyme Sets for 'classical' The following sets contain words grouped by phonetic similarity. Select one word from each group within a set to form a multi-syllabic or phrase-level rhyme. Mix and match across sets to discover even more creative possibilities. bangdancelastthankbashmatchsangbattlebackcatshatbathpathamwhamgrasscanpangraphalfblacksadcan'tcatlandjazzlaughdamnlaughscatchaxefandadtrapglasspackdancedjamhandranracksgrabsplashcrashchancecrackstagthanksdadsflashcachedfastwagclapshandsslamsrappsandsscratchragsacksnatchedlafflackbandspathsclaptrampjackvastpranceyeahnaplambmaskstashchatgangmatchedgrantzapgrandgraspslamslapstackstampstandstandsdashstanmadcapbanmaskspassedcastsaxtapvampchristmaswickedlistenwinter'chickenjinglechildrendylan'szillionsmittenvillainsenginewomenintokittentwinkleglistenchristmas'riddlekingdomlittlerhythmbridgesribbonpimplestigmapigmentninjaminutesskittlesimagewhistlekissesblissfulwrigglewrinklesvividbiscuitscheerfulmissionmistressmittendidn'tminionsdearestvistarivenprinceskitchensicknesstriplettricklekindlecrimsonbritainwitchesjigglespiritkittensrichestsilkencrystalcrystalstwinkledsizzlebrilliancevillainninjaseratwistedticklerippleinstantvisionsglistenedchildren'schipmunksvisionfearfulstillnessgigglesgigglesprinklesgiveninchesrichesdylanwisdomenglandsignalssimbascribblessimplesimpsonstrickledbrilliantribbonsrichnessbusinessbringerdancingsandwichmagicmassivenashvillelanguagetrafficrappingbangin'rappin'planetmadnessbacchusballinclassicsdanceshangingclassicashesrabbitpackagedashinggaspingblanketsalvageclappingpackingdancin'lappingjasminetranquillaughinglavishbaggagelashesbattlinglandingaxesavidrapidcatchesclassesravagepracticesmashingdazzlingcraftingparis'anguishvanishbadgestravelingsplashesstrandedvanquishedparispanickedstackinramblin'slamminslangin'ragin'language'fastin'bathin'badbitchgamin'ravishedrappinhattrickrapin'clappin'famineanvilactresspallettehat trickhabitadmitathensbattle hymnmagnetsadnesscatalystcapitalchallengepalacegadgetaddicthamletdabbingspanglishlastingcrackingrattlingcacklingtravellingmaddeningtransfixflappingthei'mcomebuckswillcanbloodbunchbumbuttonsbuttbuzzbrunchbrushblushbuckbudbugbugsbun'causechugbuffclutchbluffbuttonwhirra'emthema'bunkbunnbumpclumpclunkbudgebuskbustchunkchumbrusquechuckbulkbundlethatto'supcuz'burbsbutclungbuschumpbluntderpchubbulgebulbcluck'burghandhmmdubeens-i-r'tasmirchedclubchubbbruntchuffhmhon'buckedbubconvluddtionswuhyersbundbumfatbusschoughblubbuddthanwhatssionto'supplbuntonbroughlevinecloughbludgebuntnn'tbangdancelastthankbashmatchsangbattlebackcatshatbathpathamwhamgrasscanpangraphalfblacksadcan'tcatlandjazzlaughdamnlaughscatchaxefandadtrapglasspackdancedjamhandranracksgrabsplashcrashchancecrackstagthanksdadsflashcachedfastwagclapshandsslamsrappsandsscratchragsacksnatchedlafflackbandspathsclaptrampjackvastpranceyeahnaplambmaskstashchatgangmatchedgrantzapgrandgraspslamslapstackstampstandstandsdashstanmadcapbanmaskspassedcastsaxtapvampstillkingspringkisskicklivetearsbrickwingswindsfishchickgritwindmilkpinkripwhengivecheerssilktipkissedwinzinggiftshiphymnringlitwitchliveslimpblissjustpitchmythbuiltsingsinrichlistyearsearchilldripwillfeartwistthrillsinsdrinkswingswimsliptripiflinklipsshipsking'hit'blingwind'littlesmittenriddlekittennymphshitbeerhisskillslingpigbuildsswiftlipfitbingelinkedrippedwingpinsbringsgymdrillhitblinkyearearsdidn'tshrimpqueersriffslippedmythsswimsmissmintthei'mcomebuckswillcanbloodbunchbumbuttonsbuttbuzzbrunchbrushblushbuckbudbugbugsbun'causechugbuffclutchbluffbuttonwhirra'emthema'bunkbunnbumpclumpclunkbudgebuskbustchunkchumbrusquechuckbulkbundlethatto'supcuz'burbsbutclungbuschumpbluntderpchubbulgebulbcluck'burghandhmmdubeens-i-r'tasmirchedclubchubbbruntchuffhmhon'buckedbubconvluddtionswuhyersbundbumfatbusschoughblubbuddthanwhatssionto'supplbuntonbroughlevinecloughbludgebuntnn't Explore More Songwriting Tools Need a hand with your lyrics? Meet Lazyjot—your go-to app for smarter songwriting. From quick rhyming suggestions and rhythm-friendly syllable patterns to beat-marking tools and instant audio-to-text transcription, it’s all about making your creative process smoother, sharper, and way more fun. Frequently Asked Questions What is a rhyme dictionary? A rhyme dictionary is a tool that helps you find words that rhyme with a specific word, including perfect rhymes and multisyllabic options. How do I use this rhyme dictionary? For the best experience, head over to Lazyjot. Simply search for a word, and our rhyme dictionary will display perfect rhymes, creative rhyming phrases, and multisyllabic options to inspire your poetry or lyrics and songwriting.. Near Rhymes Here is a list of the words that nearly rhyme with the word trial. The best 35 rhymes and 2025 near rhymes for the word trial using our rhyming dictionary. Word: A word that rhymes with trials. Rhyming Percentage: How closely the word rhymes with trials. A 100 means perfect rhyme while an 80 or 90 means a close rhyme.Trial Rhymes - 233 Words and Phrases that Rhyme with Trial
ExplanationSpanish palabras que riman(rhyming words) are an essential part of the language, especially in poesía(poetry) and música(music).Why Rhyme?Rima(rhyme) is the repetition of similar sounds in two or more words. Rhyming helps create a musical quality in language and is often used to emphasize particular words or themes. Learning about Spanish rhyming words can help Spanish learners appreciate the beauty of the language and improve their own writing and speaking skills. By practicing with rhyming words, learners can develop a better ear for Spanish sounds and enhance their overall fluency.Examples of Palabras Que Riman in SpanishNow let's take a look at some examples of words that rhyme in Spanish!-Al RhymesSpanishEnglishgenialcoolidealideallealloyalmetalmetalneutralneutralrealreal-An RhymesSpanishEnglishdanthey givediránthey'll sayestánthey arefanfanflanflangrangreatpanbreadplanplanvanthey go-Ar RhymesSpanishEnglishadivinarto guessamarto loveandarto walkazarchancebailarto dancecantarto singcharlarto chatcriarto raisedarto giveestarto beestudiarto studyhablarto talkjugarto playmarseamirarto looknadarto swimparpairpintarto paintsaltarto jumpviajarto travelvolarto fly-As RhymesSpanishEnglishademásbesidesbailarásyou'll dancecantarásyou'll singcomerásyou'll eatcompáscompassdasyou givedetrásbehinddirásyou'll saydormirásyou'll sleepestudiarásyou'll studygasgasirásyou'll gojamásneverllegarásyou'll arrivemásmorepodrásyou'll be able toquizásmaybetrasafter-E RhymesSpanishEnglishbailéI dancedbañéI bathedbebébabycafécoffeedeoflehimmemepenséI thoughtporquéreasonpurépuréequéwhattendréI'll haveséI knowtéteavego-Er RhymesSpanishEnglishayeryesterdaybeberto drinkcaerto fallcomerto eatcorrerto runencenderto turn onleerto readlloverto rainplacerpleasurepoderto be able toquererto wantsaberto knowserto betenerto havetoserto coughvalerto costverto seevolverto come back-Es RhymesSpanishEnglishcortéspolitedespuésthenestrésstressinglésEnglishinterésinterestirlandésIrishmesmonthrevéssetbackresbeefrevéssetbacktresthreevesyou see-Ey RhymesSpanishEnglishbueyoxjerseysweaterleylawmagueymagueyokeyokayreykingReady to practice?Master Words That Rhyme 1 with our interactive video lessons.Comments
Rhymer is a wordsmith's dream come true for when just any word won't do.Find rhyming words with six types of rhymes:1. End Rhymes (blue/shoe)Words with ending rhyme have the same final vowel sound and following consonant sound(s). For example, if you enter the word laughter under this option, Rhymer retrieves a list of words with the ending sound er (e.g., admirer, doctor, pleasure, scholar, watercolor, and were). Other examples of ending rhyme include:hat/catplate/eightmarigold/buttonholedThis option lets you easily find exact rhymes (words in which the final vowel and consonant sounds are the same) and masculine rhymes (rhyming words with a stressed final syllable).2. Last-Syllable Rhymes (timber/harbor)Words with last-syllable rhyme have the same sounds following the last syllable boundary (commonly a consonant, a vowel, and another consonant). For example, if you enter the word explain using this option, Rhymer retrieves a list of words with the last syllable sound plain (e.g., aquaplane, biplane, plane, and plain). Other examples of last-syllable rhyme include:humanity/zestythrew/breakthroughpleat/completeThis option lets you find masculine rhymes and all other words with final syllables (stressed or unstressed) that rhyme with the word you entered.3. Double Rhymes (conviction/prediction)Words with double rhyme have the same vowel sound in the second-to-last syllable and all following sounds. For example, if you enter the word soaring using this option, Rhymer retrieves a list of words with the sound oring (e.g., adoring, exploring, pouring, scoring, touring, and restoring). Other examples of double rhyme include:walking/talkinghumming/comingnavigator/waiterThis option lets you find feminine rhymes (rhyming words with an unstressed final syllable). Words entered using this option must have at least two syllables.4. Triple Rhymes (transportation/dissertation)Words with triple rhyme have the same vowel sound in the third-to-last syllable and all following sounds. For example, if you enter the word combination using this option, Rhymer retrieves a list of words with the sound anation (e.g., explanation, coronation, destination, and imagination). Other examples of triple rhyme include:antelope/cantaloupegreenery/scenerymightily/vitallyWords entered with this option must have at least three syllables.5. Beginning Rhymes (physics/fizzle)Words with beginning rhyme have the same initial consonant sound(s) and the same first vowel sound. For example, if you enter the word plantation using this option, Rhymer retrieves a list of words with the sound pla (e.g., plan, plaque, plaster, and plateau). Other examples of beginning rhyme include:scenery/cedarcat/kangarootable/tailorThis option lets you find words with initial alliteration (the repetition of initial consonant sounds), initial assonance (the repetition of initial vowel sounds), and front rhyme (the succession of beginning sounds of words).6. First-Syllable Rhymes (carrot/caring)Words with first-syllable rhyme have the same sounds preceding the first syllable break. For example, if you enter the word explanation using this option, Rhymer retrieves a list of words with the sound ex (e.g., excavate, exhale, expert, and extra). Other examples
2025-03-31Log inWatch hundreds of videos like Rhyme Time Ep.1 - 'at' & 'it' with Cub Club☆ Rhyme Time Ep.1 - 'at' & 'it' ☆What's the time? It's Rhyme Time! This episode of Rhyme Time features words from the 'at' and 'it' families. Play along with this interactive video by putting your thumbs up if the words rhyme or thumbs down if they don't. You'll get to read rhyming sentences as well as have the chance to get your finger out and point to the word that doesn't rhyme with the others. This video provides plenty of opportunities to practise recognising, reading and listening to rhyming words. The catchy tune will help you to remember that "words that rhyme have the same end sound!"Download Circle the RhymeDownload Colour the RhymeDownload Create a RhymeDownload Find the Rhyme - PicturesDownload Find the Rhyme - WordsDownload Rhyming CardsSeriesFavouritesPopularHistoryRhyme TimeRhyme Time Ep.1 - 'at' & 'it'Rhyme Time Ep.2 - 'ap' & 'og'Rhyme Time Ep.3 - 'in' & 'ot'Rhyme Time Ep.4 - 'un' & 'ig'Rhyme Time Ep.5 - 'ug' & 'et'Rhyme Time Ep.6 - 'ip' & 'ut'Rhyme Time Ep.7 - 'ing' & 'air'Rhyme Time Ep.8 - 'all' & 'ate'
2025-04-19Rhymes Near Rhymes Advanced View Related Words Descriptive Words Homophones Same Consonant Similar Sound Words that Rhyme with trial court 1 syllable bort corte dort fort mort norte ort port porte quart short snort sort sport swart thwart tort wart torte boart boort gort skort teart whort 2 syllables abort airport alport athwart carport comport consort deport distort escort exhort extort forecourt import passport purport report resort retort seaport spaceport subport support transport apport assort cavort coalport contort homeport jetport outport presort spoilsport adhort aort- athort backcourt base-court beauport besort bistort bridgeport cold-short crosscourt descort detort downcourt e-sport esport freeport frontcourt goncourt gosport half-court hot-short kill-wart kingsport mis-sort missort outsport re-sort red-short rowport short-short shreveport skyport southport stockport thrawart touggourt trashsport wesort westport 3 syllables heliport nonsupport reexport teleport ultrashort cotransport motorsport agincourt alamort all-a-mort anteport autosport azincourt azmacort caulaincourt co-transport counterfort davenport entocort gliderport kenacort life-support mckeesport misreport modiwart multisport nasacort nieuport odd-come-short out-of-court overthwart pulmicort reassort reimport self-report self-support superport symbicort williamsport worrywart More Ideas for trial court Filter Rare Words Phrases Frequency Alphabetical
2025-04-07View synonyms for rhymerhymenounidentity in sound of some part, especially the end, of words or lines of verse.a word agreeing with another in terminal sound: Find is a rhyme for mind and womankind.verse or poetry having correspondence in the terminal sounds of the lines.a poem or piece of verse having such correspondence.verb (used with object)rhymed, rhyming.to treat in rhyme, as a subject; turn into rhyme, as something in prose.to compose (verse or the like) in metrical form with rhymes.to use (a word) as a rhyme to another word; use (words) as rhymes.verb (used without object)rhymed, rhyming.to make rhyme or verse; versify.to use rhyme in writing verse.to form a rhyme, as one word or line with another:a word that rhymes with orange.to be composed in metrical form with rhymes, as verse:poetry that rhymes./ raɪm /nounidentity of the terminal sounds in lines of verse or in wordsa word that is identical to another in its terminal sound``while'' is a rhyme for ``mile''a verse or piece of poetry having corresponding sounds at the ends of the linesthe boy made up a rhyme about his teacherany verse or piece of poetryrhyme or reason this proposal has no rhyme or reasonverbto use (a word) or (of a word) to be used so as to form a rhyme; be or make identical in soundto render (a subject) into rhymeto compose (verse) in a metrical structure A similarity of sound between words, such as moon , spoon , croon , tune , and June . Rhyme is often employed in verse.Discover MoreDerived Formsˈrhymeless, adjectiveDiscover MoreOther Words Fromrhymer nouninter·rhyme verb (used without object) interrhymed interrhymingmis·rhymed adjectivenon·rhyme nounnon·rhymed adjectivenon·rhyming adjectiveoutrhyme verb (used with object) outrhymed outrhymingun·rhyme verb (used with object) unrhymed unrhymingwell-rhymed adjectiveDiscover MoreWord History and OriginsOrigin of rhyme1First recorded in 1250–1300; Middle English rime, from Old French, derivative of rimer “to rhyme,” from unattested Gallo-Romance rimāre “to put in a row,” ultimately derived from Old High German rīm “series, row”; probably not connected with Latin rhythmus “rhythm,” although current spelling (from about 1600) is apparently by association with this wordDiscover MoreWord History and OriginsOrigin of rhyme1C12: from Old French rime , from rimer to rhyme, from Old High German rīm a number; spelling influenced by rhythmDiscover MoreIdioms and PhrasesIdiomsrhyme or reason,logic, sense, or plan:There was no rhyme or reason for what they did.Discover MoreExample SentencesZack Baun’s last name rhymes with yawn, and that was pretty much the reaction
2025-04-08